Invitrogen™ CCDC90A Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595628

Catalog No. PIPA595628

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cellhuman MDA-MB-231 whole cell, human HL-60 whole cell, human MDA-MB-453 whole cell, human A431 whole cell, human Caco-2 whole cell, rat spleen tissue, mouse lung tissue, mouse Ana-1 whole cell. IHC: human oesophagus squama cancer tissue, human ovary cancer tissue, human lung cancer tissue, human placenta tissue, human tonsil tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Mcur1 encodes a protein that is a key regulator of mitochondrial calcium uniporter (MCU) required for calcium entry into mitochondrion. Mcur1 plays a direct role in uniporter-mediated calcium uptake via a direct interaction with MCU (mitochondrial calcium uniporter). Mcur1 may be involved in the assembly of the membrane components of the uniporter complex.

Specifications

• Antigen: CCDC90A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: MCUR1
• Gene Alias: 6230416A05Rik; AU015498; AV136929; AW554392; C6orf79; C88263; Ccdc90a; coiled-coil domain containing 90A; coiled-coil domain-containing protein 90A, mitochondrial; FMP32; formin-like protein 16; MCU regulator 1; MCUR1; MCURI1; Mitochondrial calcium uniporter regulator 1; RGD1307673
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 291034, 63933, 76137
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q96AQ8, Q9CXD6
• Gene Symbols: MCUR1
• Immunogen: A synthetic peptide corresponding to a sequence of human MCUR1 (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG