Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCL18/PARC Antibody, Novus Biologicals™
SDP

Catalog No. NBP179940 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179940 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179940 Supplier Novus Biologicals Supplier No. NBP179940
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CCL18/PARC Polyclonal specifically detects CCL18/PARC in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CCL18/PARC
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_002979
Gene Alias Alternative macrophage activation-associated CC chemokine 1, AMAC1CC chemokine ligand 18, AMAC-1Small-inducible cytokine A18, chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated), CKb7, DC-CK1CC chemokine PARC, DCCK1Macrophage inflammatory protein 4, Dendritic cell chemokine 1, MIP4, MIP-4C-C motif chemokine 18, PARCPulmonary and activation-regulated chemokine, SCYA18chemokine (C-C), dendritic, small inducible cytokine A18, small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary andactivation-regulated
Gene Symbols CCL18
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human CCL18. Peptide sequence PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA.
Molecular Weight of Antigen 10 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 6362
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.