CCL18/PARC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179940

Catalog No. NBP179940

Description

CCL18/PARC Polyclonal specifically detects CCL18/PARC in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCL18/PARC
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Alternative macrophage activation-associated CC chemokine 1, AMAC1CC chemokine ligand 18, AMAC-1Small-inducible cytokine A18, chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated), CKb7, DC-CK1CC chemokine PARC, DCCK1Macrophage inflammatory protein 4, Dendritic cell chemokine 1, MIP4, MIP-4C-C motif chemokine 18, PARCPulmonary and activation-regulated chemokine, SCYA18chemokine (C-C), dendritic, small inducible cytokine A18, small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary andactivation-regulated
• Host Species: Rabbit
• Molecular Weight of Antigen: 10 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 6362
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_002979
• Gene Symbols: CCL18
• Immunogen: Synthetic peptide directed towards the middle region of human CCL18. Peptide sequence PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only