Learn More
Description
Specifications
Specifications
| Antigen | CCL19/MIP-3 beta |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | beta chemokine exodus-3, Beta-chemokine exodus-3, CC chemokine ligand 19, C-C motif chemokine 19, chemokine (C-C motif) ligand 19, CKb11, EBI1-ligand chemokine, ELCMIP-3-beta, Epstein-Barr virus-induced molecule 1 ligand chemokine, exodus-3, Macrophage inflammatory protein 3 beta, macrophage inflammatory protein 3-beta, MGC34433, MIP-3b, MIP3BCK beta-11, SCYA19EBI1 ligand chemokine, small inducible cytokine subfamily A (Cys-Cys), member 19, Small-inducible cytokine A19 |
| Gene Symbols | CCL19 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
