Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCL19/MIP-3 beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP256275
Description
CCL19/MIP-3 beta Polyclonal specifically detects CCL19/MIP-3 beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CCL19/MIP-3 beta | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
beta chemokine exodus-3, Beta-chemokine exodus-3, CC chemokine ligand 19, C-C motif chemokine 19, chemokine (C-C motif) ligand 19, CKb11, EBI1-ligand chemokine, ELCMIP-3-beta, Epstein-Barr virus-induced molecule 1 ligand chemokine, exodus-3, Macrophage inflammatory protein 3 beta, macrophage inflammatory protein 3-beta, MGC34433, MIP-3b, MIP3BCK beta-11, SCYA19EBI1 ligand chemokine, small inducible cytokine subfamily A (Cys-Cys), member 19, Small-inducible cytokine A19 | |
Rabbit | |
Affinity Purified | |
RUO | |
6363 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
CCL19 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction