Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCL21/6Ckine Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP23792825UL
Description
CCL21/6Ckine Polyclonal specifically detects CCL21/6Ckine in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CCL21/6Ckine | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
O00585 | |
CCL21 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT | |
25 μL | |
Cancer, Cell Cycle and Replication | |
6366 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
6CkineSmall-inducible cytokine A21, Beta-chemokine exodus-2, chemokine (C-C motif) ligand 21, CKb9, member 21, SCYA21MGC34555, secondary lymphoid tissue chemokine, SLCSecondary lymphoid-tissue chemokine | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction