Abnova™ CCNB1IP1 Recombinant Protein

Description

Recombinant protein for CCNB1IP1 gene

HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.

• Human CCNB1IP1 full-length ORF ( NP_878269.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal
• Theoretical molecular weight: 57.9kDa
• Preparation: in vitro wheat germ system
• Purification: glutathione sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNIT IANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array

Specifications

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 57.9
• Name: Human CCNB1IP1 Full-length ORF Recombinant Protein with GST-tag at N-terminal
• pH Range: 8
• Preparation Method: In vitro wheat germ expression system
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
• Quantity: 10 μg
• Source: Wheat Germ (in vitro)
• Storage Requirements: -80°C
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution