Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCNY Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CCNY |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1580720
|
Novus Biologicals
NBP15807120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP158071
|
Novus Biologicals
NBP158071 |
100 μL |
Each for $487.50
|
|
|||||
Description
CCNY Polyclonal specifically detects CCNY in Human samples. It is validated for Western Blot.Specifications
| CCNY | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| CBCP1C10orf9cyc-Y, CCNX, CFP 1, CFP1FLJ95513, chromosome 10 open reading frame 9, Cyclin box protein 1, Cyclin fold protein 1, cyclin Y, cyclin-box carrying protein 1, cyclin-X, cyclin-Y, Cyc-Y | |
| CCNY | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8ND76 | |
| 219771 | |
| Synthetic peptides corresponding to CCNY(cyclin Y) The peptide sequence was selected from the middle region of CCNY. Peptide sequence DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title