CCR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324720

Catalog No. NB301732

Description

CCR2 Polyclonal antibody specifically detects CCR2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: CCR2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: C-C chemokine receptor type 2, C-C CKR-2, CC-CKR-2CKR2B, CCR-2, CCR2A, CCR2B, CD192, CD192 antigen, chemokine (C-C motif) receptor 2, CKR2, CKR2A, CMKBR2MGC111760, FLJ78302, MCP-1 receptor, MCP-1-RMGC103828, MGC168006, Monocyte chemoattractant protein 1 receptor, monocyte chemotactic protein 1 receptor
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CCR2 using the following amino acid sequence: FHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEG
• Quantity: 100 μL
• Research Discipline: Chemokines and Cytokines, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction
• Gene ID (Entrez): 729230
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified