Learn More
Description
Specifications
Specifications
| Antigen | CCR7 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | BLR2C-C chemokine receptor type 7, C-C CKR-7, CC-CKR-7, CCR-7, CD197, CD197 antigen, CDw197CC chemokine receptor 7, chemokine (C-C motif) receptor 7, CMKBR7chemokine (C-C) receptor 7, EBI1EBV-induced G protein-coupled receptor 1, EBV-induced G-protein coupled receptor 1, Epstein-Barr virus induced gene 1, Epstein-Barr virus induced G-protein coupled receptor, Epstein-Barr virus-induced G-protein coupled receptor 1, EVI1, lymphocyte-specific G protein-coupled peptide receptor, MIP-3 beta receptor |
| Gene Symbols | CCR7 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
