Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCRL2/CRAM-A/B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18558825UL
Description
CCRL2/CRAM-A/B Polyclonal specifically detects CCRL2/CRAM-A/B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CCRL2/CRAM-A/B | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
C-C chemokine receptor-like 2, CCR11, CCR6, chemokine (C-C motif) receptor-like 2, Chemokine receptor CCR11, Chemokine receptor X, CKRXMGC116710, CRAM, CRAM-A, CRAM-B, FLJ55815, HCRMGC34104, Putative MCP-1 chemokine receptor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CCRL2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV | |
25 μL | |
GPCR, Immunology, Innate Immunity | |
9034 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction