Invitrogen™ CCT3 Monoclonal Antibody (12H4)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA527872

Catalog No. PIMA527872

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human MCF-7 whole cell, human COLO-320 whole cell, human HepG2 whole cell. ICC/IF: A431 cell.

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Specifications

• Antigen: CCT3
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P49368
• Gene Symbols: Cct3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1

• Applications: Western Blot, Immunocytochemistry
• Clone: 12H4
• Conjugate: Unconjugated
• Gene: Cct3
• Gene Alias: AL024092; CCT3; CCTG; CCT-gamma; chaperonin containing TCP1 subunit 3; chaperonin containing Tcp1, subunit 3 (gamma); chaperonin subunit 3 (gamma); hTRiC5; Matricin; mTRiC-P5; OTTHUMP00000025735; PIG48; T-complex protein 1 subunit gamma; T-complex protein 1, gamma subunit; TCP1 (t-complex-1) ring complex, polypeptide 5; TCP-1-gamma; Tcp1-rs3; TRIC5; TriC-P5
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 7203
• Content And Storage: -20°C
• Form: Lyophilized