Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCT3 Mouse anti-Human, Clone: 12H4, Invitrogen™

Mouse Monoclonal Antibody

Manufacturer:  Invitrogen MA527872

Catalog No. PIMA527872


Add to cart

Description

Description

The synthetic peptide sequence is 497-536aa, EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ Product may be stored at -20C for one year. After reconstitution, at 4C for one month. Product can also be aliquotted and stored frozen at -20C for a longer time. Avoid repeated freezing and thawing. Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex, also known as the TCP1 ring complex. This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
Specifications

Specifications

CCT3
Monoclonal
Unconjugated
CCT3
Lyophilized
CCT3
A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3.
Antigen affinity chromatography
RUO
Antibody
Monoclonal
Human
Western Blot
12H4
PBS with 4MG trehalose, 4MG trehalose and 0.05MG sodium azide, 0.05MG sodium azide
P49368
T-complex protein 1 subunit gamma, TCP-1-gamma, CCT-gamma, hTRiC5, CCT3, CCTG, TRIC5
Mouse
IgG1
100 μg
-20°C
Primary
7203
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit