Invitrogen™ CCT3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578953

Catalog No. PIPA578953

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell, human A549 whole cell, human Hela whole cell, human MCF-7 whole cell, rat brain tissue, rat lung tissue, mouse brain tissue, mouse lung tissue. IHC: human lung cancer tissue, human mammary cancer tissue, human intestinal cancer tissue, human placenta tissue. ICC/IF: A431 cell, A431 cell. Flow: PC-3 cell, K562 cell, U251 cell.

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Specifications

• Antigen: CCT3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Cct3
• Gene Alias: AL024092; CCT3; CCTG; CCT-gamma; chaperonin containing TCP1 subunit 3; chaperonin containing Tcp1, subunit 3 (gamma); chaperonin subunit 3 (gamma); hTRiC5; Matricin; mTRiC-P5; OTTHUMP00000025735; PIG48; T-complex protein 1 subunit gamma; T-complex protein 1, gamma subunit; TCP1 (t-complex-1) ring complex, polypeptide 5; TCP-1-gamma; Tcp1-rs3; TRIC5; TriC-P5
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 12462, 295230, 7203
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.01mg sodium azide
• Gene Accession No.: P49368, P80318, Q6P502
• Gene Symbols: Cct3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG