Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CCT6A Antibody, Novus Biologicals™

CCT6A Antibody, Novus Biologicals™
SDP

Catalog No. NB396346 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396346 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396346 Supplier Novus Biologicals Supplier No. NBP24671525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CCT6A Polyclonal antibody specifically detects CCT6A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen CCT6A
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P40227
Gene Alias acute morphine dependence related protein 2, Acute morphine dependence-related protein 2, amino acid transport defect-complementing, CCT6, Cctz, CCT-zeta, CCT-zeta-1, chaperonin containing T-complex subunit 6, chaperonin containing TCP1, subunit 6A (zeta 1), histidine transport regulator 3, HTR3MGC126215, MGC126214, MoDP-2, T-complex protein 1 subunit zeta, T-complex protein 1, zeta subunit, TCP-1-zeta, TCP20, TCPZ, TTCP20
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVL
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 908
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.