Invitrogen™ CD105 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595428

Catalog No. PIPA595428

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SiHa whole cell, human Hela whole cell. Flow: U87 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

CD105 or Endoglin is a Type I transmembrane protein, which is highly expressed on human vascular endothelial cells. It exists on an O- and N-glycosylated homodimer. Up regulation of endoglin expression has been demonstrated in tumor vasculature and proliferating cells, suggesting that it is a proliferation associated endothelial marker. CD105 binds to TGF beta 1 and 3 with high affinity but not to TGF beta 2.

Specifications

• Antigen: CD105
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ENG
• Gene Alias: AI528660; AI662476; CD105; CD105 antigen; cell surface MJ7/18 antigen; Edg; END; Endo; Endoglin; endoglin (Osler-Rendu-Weber syndrome 1); Eng; HHT1; ORW; ORW1; S-endoglin; transmembrane glycoprotein
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2022
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P17813
• Gene Symbols: ENG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD105 (258-297aa YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov