Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ CD127 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA579511
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: 22RV1 whole cell. Flow: U20S cell, U87 cell.
CD127 (Interleukin-7, IL-7) is a glycoprotein involved in the regulation of lymphopoiesis. The response of cells to CD127 is dependent on the presence of the interleukin 7 receptor (IL7R); the active receptor is an alpha/gamma chain heterodimer. CD127 consists of an alpha chain and a gamma chain. The gamma(c) chain, which also associates with the interleukin-2 receptor, serves primarily to activate signal transduction by the IL7R complex, while the alpha chain of IL7R determines specific signaling events through its association with cytoplasmic signaling molecules. CD127 promotes the proliferation of precursor B cells, thymocytes, T cell progenitors, and mature CD4+ and CD8+ T cells. The biological effects of IL7 are mediated by the binding of IL7 to the specific cell surface receptor. Diseases associated with CD127 dysfunction include severe combined immunodeficiency and T cell negative/B cell negative/NK positive severe combined immunodeficiency.
Specifications
CD127 | |
Polyclonal | |
Unconjugated | |
Il7r | |
CD127; CD127 antigen; CDW127; IL 7 receptor; IL 7R a; IL 7R subunit alpha; IL 7R a; IL 7Ra; IL 7Ra; IL7 receptor; IL-7 receptor alpha chain; IL7 receptor subunit alpha; IL-7 receptor subunit alpha; IL7R; IL-7R; IL7R a; IL7R alpha; IL7R subunit alpha; IL-7R subunit alpha; IL7R a; IL7RA; IL-7RA; IL-7Ralpha; IL-7R-alpha; IL7Ra; ILRA; interleukin 7 receptor; interleukin 7 receptor alpha chain; interleukin 7 receptor isoform H5-6; Interleukin7 receptor subunit alpha; interleukin-7 receptor subunit alpha; MGC107557; sCD127; soluble IL 7 receptor; soluble IL 7R | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
294797, 3575 | |
-20°C | |
Lyophilized |
Flow Cytometry, Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
P16871 | |
Il7r | |
A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ). | |
100 μg | |
Primary | |
Human, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction