Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ CD127 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579511
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579511 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579511 Supplier Invitrogen™ Supplier No. PA579511
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: 22RV1 whole cell. Flow: U20S cell, U87 cell.

CD127, also known as the Interleukin-7 receptor alpha chain (IL-7Ralpha), is a type I glycoprotein with a molecular weight of 75-80 kDa. It forms a multi-functional receptor complex with CD132, the common gamma chain, to create the IL-7 receptor (IL-7R), which is crucial for lymphopoiesis. The active IL-7 receptor is an alpha/gamma chain heterodimer, where the gamma chain also associates with the interleukin-2 receptor and primarily activates signal transduction, while the alpha chain determines specific signaling events through its association with cytoplasmic signaling molecules. CD127 is expressed by immature B cells through the early pre-B stage, thymocytes during various stages of development, and most mature T cells, with transient down-regulation upon activation. It promotes the proliferation of precursor B cells, thymocytes, T cell progenitors, and mature CD4+ and CD8+ T cells. Binding of IL-7 to CD127 results in signal transduction through several tyrosine kinase pathways, including the Jak/STAT pathway, and is indispensable for lymphocyte development and the control of homeostatic proliferation of T cells in the periphery. Additionally, IL-7R signaling is involved in the regulation of T cell receptor (TCR) locus rearrangement in gamma delta T cells. Interestingly, CD127 expression is down-regulated on CD4+CD25+ regulatory T cells (T regs). While CD4 and CD25 co-expression is commonly used to identify T regs, this method may include cells without suppressive activity. CD4+CD25+ cells that have down-regulated CD127 expression are significantly enriched for the regulatory T cell population, as defined by the expression of the T reg-specific transcription factor Foxp3 and their suppressive activity in vitro. Diseases associated with CD127 dysfunction include severe combined immunodeficiency and T cell negative/B cell negative/NK positive severe combined immunodeficiency.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD127
Applications Flow Cytometry, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Il7r
Gene Accession No. P16871
Gene Alias CD127; CD127 antigen; CDW127; IL 7 receptor; IL 7R a; IL 7R subunit alpha; IL 7R α; IL 7Ra; IL 7Rα; IL7 receptor; IL-7 receptor alpha chain; IL7 receptor subunit alpha; IL-7 receptor subunit alpha; IL7R; IL-7R; IL7R a; IL7R alpha; IL7R subunit alpha; IL-7R subunit alpha; IL7R α; IL7RA; IL-7RA; IL-7Ralpha; IL-7R-alpha; IL7Rα; ILRA; interleukin 7 receptor; interleukin 7 receptor alpha chain; interleukin 7 receptor isoform H5-6; Interleukin7 receptor subunit alpha; interleukin-7 receptor subunit alpha; MGC107557; sCD127; soluble IL 7 receptor; soluble IL 7R
Gene Symbols Il7r
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 294797, 3575
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.