Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD14 Antibody (CL1637), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $646.00

Specifications

Antigen	CD14
Clone	CL1637
Dilution	Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Monoclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB436555 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23448525UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP234485 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP234485	0.1 mL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CD14 Monoclonal specifically detects CD14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	CD14
Dilution	Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	CD14 antigen, CD14 molecule, monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein
Gene Symbols	CD14
Isotype	IgG1
Purification Method	Protein A purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Clone	CL1637
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Mouse
Research Discipline	Adaptive Immunity, Apoptosis, Asthma, Cancer, Cell Biology, Cytokine Research, Immunology, Innate Immunity, Myeloid Cell Markers, Stem Cell Markers
Gene Accession No.	D6RFL4
Gene ID (Entrez)	929
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CD14 Antibody (CL1637), Novus Biologicals™

Specifications

Description

Specifications

Documents