CD161 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188130

Catalog No. NBP188130

Description

CD161 Polyclonal specifically detects CD161 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD161
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q12918
• Gene Symbols: KLRB1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
• Quantity: 0.1 mL
• Research Discipline: Innate Immunity, Signal Transduction
• Gene ID (Entrez): 3820
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD161, CD161 antigen, CLEC5BC-type lectin domain family 5 member B, HNKR-P1a, killer cell lectin-like receptor subfamily B member 1, killer cell lectin-like receptor subfamily B, member 1, Natural killer cell surface protein P1A, NKR-P1, NKR-P1AMGC138614, NKRP1ANKR
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only