Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579573

Invitrogen™ CD171 (L1CAM) Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579573
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579573 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579573 Supplier Invitrogen™ Supplier No. PA579573
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse brain tissue, mouse brain tissue, rat brain tissue, human colon cancer tissue, human glioma tissue, human lung cancer tissue, human mammary cancer tissue.

L1CAM/CD171 is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of a neuron-specific exon is thought to be functionally relevant.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD171 (L1CAM)
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene L1CAM
Gene Accession No. P11627, P32004, Q05695
Gene Alias antigen identified by monoclonal antibody R1; CAML1; CD 171; CD171; CD171 molecule; HSAS; HSAS1; Hyd; L1; L1 cell adhesion molecule; L1CAM; MASA; MIC5; N-CAM L1; NCAML1; N-CAML1; N-CAM-L1; NCAM-L1; Nerve-growth factor-inducible large external glycoprotein; neural cell adhesion molecule L1; NILE; S10; sCD171; sL1 CAM; sL1CAM; soluble CD 171; soluble CD171; soluble L1 CAM; soluble L1CAM; SPG1
Gene Symbols L1CAM
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 16728, 3897, 50687
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.