Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD177 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25897925UL
Description
CD177 Polyclonal specifically detects CD177 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CD177 | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
CD177 antigenNB1 GP, CD177 molecule, HNA-2a, HNA2Acell surface receptor, Human neutrophil alloantigen 2a, NB1PRV-1, polycythemia rubra vera 1, Polycythemia rubra vera protein 1, PRV1NB1 glycoprotein | |
Rabbit | |
Affinity Purified | |
RUO | |
57126 | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
CD177 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNL | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction