Invitrogen™ CD19 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595326

Catalog No. PIPA595326

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Raji whole cell, human Ramos whole cell, human Daudi whole cell. IHC: human appendix tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

CD19 is a member of the immunoglobulin superfamily and has two Ig like domains. The CD19 molecule is expressed on 100% of the peripheral B cells as defined by expression of kappa or lambda light chains. CD19 appears to be expressed on myeloid leukemia cells, particularly those of monocytic lineage. Leukemia phenotype studies have demonstrated that the earliest and broadest B cell restricted antigen is the CD19 antigen. The receptor for CD19 is an important functional regulator of normal and malignant B cell proliferation, and is expressed in all B cell precursor leukemias. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. CD19 is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. Besides being a signal-amplifying coreceptor for the B cell receptor (BCR), CD19 can also signal independently of BCR co-ligation and is a central regulatory component upon which multiple signaling pathways converge. Mutation of the CD19 gene results in hypogammaglobulinemia, whereas CD19 overexpression causes B cell hyperactivity.

Specifications

• Antigen: CD19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Cd19
• Gene Alias: AW495831; B4; B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Cd19; CD19 antigen; CD19 molecule; CVID3; differentiation antigen CD19; Leu-12; T-cell surface antigen Leu-12
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 930
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P15391
• Gene Symbols: Cd19
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov