CD21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP238895

Catalog No. NBP238895

Description

CD21 Polyclonal specifically detects CD21 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD21
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P20023
• Gene Symbols: CR2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS
• Quantity: 0.1 mL
• Research Discipline: Adaptive Immunity, Dendritic Cell Markers, Immunology
• Gene ID (Entrez): 1380
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C3DRSLEB9, CD21, CD21 antigen, Complement C3d receptor, complement component (3d/Epstein Barr virus) receptor 2, complement receptor type 2, Cr2, EBV receptor, Epstein-Barr virus receptor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.