Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA126368

Invitrogen™ CD263 (TRAIL-R3) Polyclonal Antibody

Catalog No. PIPA126368
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA126368 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA126368 Supplier Invitrogen™ Supplier No. PA126368
Add to Cart
Add to Cart

Description

Goat Polyclonal Antibody

Recommended positive controls: Human embryonic kidney cell line-293 or human T-cell line Jurkat. Store product as a concentrated solution. Centrifuge briefly prior to opening the vial.

TRAIL-R3 (CD263) is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD263 (TRAIL-R3)
Applications ELISA, Flow Cytometry, Immunohistochemistry, Western Blot
Classification Polyclonal
Concentration 2 mg/mL
Conjugate Unconjugated
Formulation PBS with 0.1% BSA and 0.1% sodium azide
Gene TNFRSF10C
Gene Accession No. O14798
Gene Alias Antagonist decoy receptor for TRAIL/Apo-2L; CD263; cytotoxic TRAIL receptor-3; DCR1; DCR1-TNFR; Decoy receptor 1; decoy TRAIL receptor without death domain; LIT; lymphocyte inhibitor of TRAIL; MGC149501; MGC149502; TNF receptor superfamily member 10c; TNF-related apoptosis-inducing ligand receptor 3; TNFRSF10C; TRAIL receptor 3; TRAIL receptor without an intracellular domain; TRAILR3; TRAIL-R3; TRID; Tumor necrosis factor receptor superfamily member 10C; tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain; UNQ321/PRO366
Gene Symbols TNFRSF10C
Host Species Goat
Immunogen Synthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 472713, 8794
Target Species Chimpanzee, Human, Mouse
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.