Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ CD263 (TRAIL-R3) Polyclonal Antibody
Goat Polyclonal Antibody
Supplier: Invitrogen™ PA126368
Description
Recommended positive controls: Human embryonic kidney cell line-293 or human T-cell line Jurkat. Store product as a concentrated solution. Centrifuge briefly prior to opening the vial.
TRAIL-R3 (CD263) is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL.
Specifications
| CD263 (TRAIL-R3) | |
| Polyclonal | |
| Unconjugated | |
| TNFRSF10C | |
| Antagonist decoy receptor for TRAIL/Apo-2L; CD263; cytotoxic TRAIL receptor-3; DCR1; DCR1-TNFR; Decoy receptor 1; decoy TRAIL receptor without death domain; LIT; lymphocyte inhibitor of TRAIL; MGC149501; MGC149502; TNF receptor superfamily member 10c; TNF-related apoptosis-inducing ligand receptor 3; TNFRSF10C; TRAIL receptor 3; TRAIL receptor without an intracellular domain; TRAILR3; TRAIL-R3; TRID; Tumor necrosis factor receptor superfamily member 10C; tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain; UNQ321/PRO366 | |
| Goat | |
| Antigen affinity chromatography | |
| RUO | |
| 472713, 8794 | |
| Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. | |
| Liquid |
| ELISA, Flow Cytometry, Immunohistochemistry, Western Blot | |
| 2 mg/mL | |
| PBS with 0.1% BSA and 0.1% sodium azide | |
| O14798 | |
| TNFRSF10C | |
| Synthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1). | |
| 100 μg | |
| Primary | |
| Chimpanzee, Human, Mouse | |
| Antibody | |
| IgG |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction