Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD27/TNFRSF7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CD27/TNFRSF7 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CD27/TNFRSF7 Polyclonal specifically detects CD27/TNFRSF7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CD27/TNFRSF7 | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Immunology, Innate Immunity | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CD27 antigen, CD27 molecule, MGC20393, S152CD27L receptor, T cell activation antigen CD27, T cell activation antigen S152, T14, TNFRSF7T-cell activation antigen CD27, Tp55, Tumor necrosis factor receptor superfamily member 7, tumor necrosis factor receptor superfamily, member 7 | |
CD27 | |
IgG | |
Affinity Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P26842 | |
939 | |
This antibody was developed against a recombinant protein corresponding to amino acids: HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title