CD276 (28-238) Mouse anti-Human, Clone: 7G6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CD276.

Supplier:  Abnova Corporation H00080381M11

Catalog No. 89-933-765

Description

Costimulatory B7 molecules (e.g., B7-1, or CD80; MIM 112203) signal through CD28 (MIM 186760) family molecules such as CD28, CTLA4 (MIM 123890), and ICOS (MIM 604558).[supplied by OMIM]

Sequence: ALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTIT

Specifications

• Antigen: CD276 (28-238)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC062581.1
• Gene Symbols: CD276
• Immunogen: CD276 (AAH62581.1,28 a.a. ∽ 238 a.a) partial recombinant protein.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Test Specificity: Antibody Reactive Against Recombinant Protein.
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: ELISA, Immunofluorescence
• Clone: 7G6
• Description: Mouse monoclonal antibody raised against a partial recombinant CD276.
• Gene: CD276
• Gene Alias: B7-H3/B7H3
• Host Species: Mouse
• Purification Method: Protein A/G purification
• Regulatory Status: RUO
• Gene ID (Entrez): 80381
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ