Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD276 (28-238) Mouse anti-Human, Clone: 7G6, Abnova™

Catalog No. 89933765 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-933-765 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-933-765 Supplier Abnova Corporation Supplier No. H00080381M11
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CD276.

Costimulatory B7 molecules (e.g., B7-1, or CD80; MIM 112203) signal through CD28 (MIM 186760) family molecules such as CD28, CTLA4 (MIM 123890), and ICOS (MIM 604558).[supplied by OMIM]

Sequence: ALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTIT

Specifications

Antigen CD276 (28-238)
Applications ELISA, Immunofluorescence
Classification Monoclonal
Clone 7G6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CD276.
Formulation PBS with no preservative; pH 7.4
Gene CD276
Gene Accession No. BC062581.1
Gene Alias B7-H3/B7H3
Gene Symbols CD276
Host Species Mouse
Immunogen CD276 (AAH62581.1,28 a.a. ∽ 238 a.a) partial recombinant protein.
Purification Method Protein A/G purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 80381
Test Specificity Antibody Reactive Against Recombinant Protein.
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.