Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD276 Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human CD276.

Manufacturer:  Abnova Corporation PAB29313

Catalog No. 89-933-766


Add to cart

Description

Description

Costimulatory B7 molecules (e.g., B7-1, or CD80; MIM 112203) signal through CD28 (MIM 186760) family molecules such as CD28, CTLA4 (MIM 123890), and ICOS (MIM 604558).[supplied by OMIM]

Sequence: EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG
Specifications

Specifications

CD276
Unconjugated
Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Liquid
CD276
Recombinant protein corresponding to amino acids 30-130 of human CD276.
Antigen affinity purification
RUO
Primary
80381
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant human CD276.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
B7-H3/B7H3
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit