Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25701525UL
Description
CD28 Polyclonal specifically detects CD28 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CD28 | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
CD28 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS | |
25 μL | |
Adaptive Immunity, Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Neuroscience, Signal Transduction | |
940 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Polyclonal | |
Immunohistochemistry-Paraffin 1:50 - 1:200 | |
CD28 antigen, CD28 antigen (Tp44), CD28 molecule, MGC138290, T-cell-specific surface glycoprotein CD28, Tp44 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction