CD28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257015

Catalog No. NBP257015

Description

CD28 Polyclonal specifically detects CD28 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD28
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CD28 antigen, CD28 antigen (Tp44), CD28 molecule, MGC138290, T-cell-specific surface glycoprotein CD28, Tp44
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CD28
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
• Quantity: 100 μL
• Research Discipline: Adaptive Immunity, Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Neuroscience, Signal Transduction
• Gene ID (Entrez): 940
• Target Species: Human
• Isotype: IgG

For Research Use Only