Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ CD2F-10/SLAMF9 Protein
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP184593PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLAMF9. The CD2F-10/SLAMF9 Recombinant Protein Antigen is derived from E. coli. The CD2F-10/SLAMF9 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
89886 | |
Chromatography | |
0.5mg/mL | |
PBS and 1M Urea, pH 7.4. | |
SLAMF9 | |
25kDa | |
0.1mL | |
E.Coli |
Human | |
>80% | |
Store at -20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
Unlabeled | |
CD2F-10/SLAMF9 | |
RUO | |
TYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAF |
Safety and Handling
ShelfLife : 365
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction