Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD300a/LMIR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317815100UL
Description
CD300a/LMIR1 Polyclonal antibody specifically detects CD300a/LMIR1 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| CD300a/LMIR1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| CD300a antigenCMRF35H9, CD300a molecule, CLM-8, CMRF-35H, CMRF35-H, CMRF35H leukocyte immunoglobulin-like receptor, CMRF35-H9, CMRF-35-H9CD300 antigen-like family member A, CMRF35HIRp60, CMRF35-like molecule 8, IgSF12, IGSF12NK inhibitory receptor, Immunoglobulin superfamily member 12, Inhibitory receptor protein 60, IRC1, IRC1/IRC2, IRC2, Irp60, leukocyte membrane antigen | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK | |
| 100 μg | |
| Mast Cell Markers | |
| 11314 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction