Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD300f/LMIR3/CD300LF Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310774100UL
Description
CD300f/LMIR3/CD300LF Polyclonal specifically detects CD300f/LMIR3/CD300LF in Human samples. It is validated for Western Blot.Specifications
CD300f/LMIR3/CD300LF | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CMRF35-like molecule 1, CD300 molecule-like family member f, CD300f, CLM1, CLM-1, IgSF13, IREM1, IREM-1, NKIR | |
The immunogen is a synthetic peptide directed towards the middle region of Human CD300f/LMIR3/CD300LF. Peptide sequence IWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYW | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
146722 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction