Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD37 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP233970
Description
CD37 Polyclonal specifically detects CD37 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CD37 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
P11049 | |
CD37 | |
This antibody was developed against a recombinant protein corresponding to amino acids: ISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEA | |
0.1 mL | |
Cellular Markers, Immunology | |
951 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CD37 antigentetraspanin-26, CD37 molecule, cell differentiation antigen 37, GP52-40, leukocyte antigen CD37, MGC120234, Tetraspanin-26, Tspan-26, TSPAN26leukocyte surface antigen CD37 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction