CD40/TNFRSF5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233956

Catalog No. NBP233956

Description

CD40/TNFRSF5 Polyclonal specifically detects CD40/TNFRSF5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD40/TNFRSF5
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P25942
• Gene Symbols: CD40
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
• Quantity: 0.1 mL
• Research Discipline: Adaptive Immunity, Apoptosis, Asthma, Cancer, Hematopoietic Stem Cell Markers, Immunology, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 958
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: B cell surface antigen CD40, B-cell surface antigen CD40, Bp50B cell-associated molecule, CD40 antigen, CD40 molecule, TNF receptor superfamily member 5, CD40 type II isoform, CD40L receptor, CDw40, MGC9013, nerve growth factor receptor-related B-lymphocyte activation molecule, p50, TNFRSF5CD40 antigen (TNF receptor superfamily member 5), tumor necrosis factor receptor superfamily member 5, tumor necrosis factor receptor superfamily, member 5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only