Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD48/SLAMF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25544525UL
Description
CD48/SLAMF2 Polyclonal specifically detects CD48/SLAMF2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CD48/SLAMF2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
BCM1 surface antigen, BCM1Leukocyte antigen MEM-102, BLAST, BLAST1TCT.1, B-lymphocyte activation marker BLAST-1, CD48 antigen, CD48 antigen (B-cell membrane protein), CD48 molecule, hCD48, mCD48, MEM-102, SLAMF2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CD48 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV | |
25 μL | |
Cell Biology, Cellular Markers, Immunology, Stem Cell Markers | |
962 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction