Novus Biologicals™ CD48/SLAMF2 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD48/SLAMF2. Source: E.coli Amino Acid Sequence: VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV The CD48/SLAMF2 Recombinant Protein Antigen is derived from E. coli. The CD48/SLAMF2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 962
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: CD48/SLAMF2 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: BCM1 surface antigen, BCM1Leukocyte antigen MEM-102, BLAST, BLAST1TCT.1, B-lymphocyte activation marker BLAST-1, CD48 antigen, CD48 antigen (B-cell membrane protein), CD48 molecule, hCD48, mCD48, MEM-102, SLAMF2
• Gene Symbol: CD48
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51997. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only