Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ CD5 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA578989
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Jurkat whole cell, human CCRF-CEM whole cell, human MOLT-4 whole cell, rat thymus tissue, mouse thymus tissue. Flow: Jurkat cell.
CD5 is a 67 kDa human T-lymphocyte single-chain transmembrane glycoprotein. CD5 is present on all mature T-lymphocytes, on most of thymocytes and on many T-cell leukemias and lymphomas. CD5 also reacts with a subpopulation of activated B-cells and may act as a receptor in regulating T-cell proliferation. CD5 is found on 95% of thymocytes and 72% of peripheral blood lymphocytes. In lymph nodes, the main reactivity is observed in T cell areas. CD5 is expressed by many T cell leukemia, lymphomas, and activated T cells. Diseases associated with CD5 dysfunction include thymus cancer and Richter's Syndrome.
Specifications
CD5 | |
Polyclonal | |
Unconjugated | |
Cd5 | |
alanyl (membrane) aminopeptidase; alanyl aminopeptidase; alanyl aminopeptidase, membrane; aminopeptidase M; Aminopeptidase N; ANPEP; AP-M; APN; AP-N; CD antigen CD5; CD13; CD28; CD28 antigen (Tp44); CD28 molecule; Cd5; CD5 antigen; CD5 antigen (p56 62); CD5 antigen (p56-62); CD5 antigen p56-62; CD5 molecule; CD5 protein; CD74 antigen, invariant polypeptide of major; cell surface protein; costimulatory molecule B7 receptor CD28; fCD5; GP150; hAPN; LAP1; LEU1; Ly-1; Ly12; Ly-12; LyA; Ly-A; Lymphocyte antigen 1; Lymphocyte antigen CD5; lymphocyte antigen T1/Leu-1; Lyt-1; membrane alanyl aminopeptidase; microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; P150; Pan T cell; PEPN; T1; T-cell costimulatory molecule CD28; T-cell surface glycoprotein CD5; T-cell-specific surface glycoprotein CD28; unnamed protein product | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
12507, 54236, 921 | |
-20°C | |
Lyophilized |
Flow Cytometry, Western Blot | |
500 μg/mL | |
PBS with 4mg trehalose and no preservative | |
P06127, P13379, P51882 | |
Cd5 | |
A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction