Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CD5L |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CD5L Polyclonal specifically detects CD5L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CD5L | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
O43866 | |
922 | |
This antibody was developed against a recombinant protein corresponding to amino acids: SCSGREATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
Polyclonal | |
Rabbit | |
Apoptosis | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
AIM, API6, apoptosis inhibitor 6, CD5 antigen-like, CD5 antigen-like (scavenger receptor cysteine rich family), CD5 molecule-like, CT-2, IgM-associated peptide, PRO229, Spalpha, SP-ALPHA | |
CD5L | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title