CD5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP239094

Catalog No. NBP239094

Description

CD5L Polyclonal specifically detects CD5L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD5L
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: O43866
• Gene Symbols: CD5L
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC
• Quantity: 0.1 mL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 922
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AIM, API6, apoptosis inhibitor 6, CD5 antigen-like, CD5 antigen-like (scavenger receptor cysteine rich family), CD5 molecule-like, CT-2, IgM-associated peptide, PRO229, Spalpha, SP-ALPHA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.