CD7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23844025UL

Catalog No. NB436207

Description

CD7 Polyclonal specifically detects CD7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD7
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P09564
• Gene Symbols: CD7
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAAS
• Quantity: 25 μL
• Research Discipline: Cytokine Research, Signal Transduction
• Gene ID (Entrez): 924
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD7 antigen, CD7 antigen (p41), CD7 molecule, GP40T-cell surface antigen Leu-9, LEU-9, T-cell antigen CD7, T-cell leukemia antigen, Tp40, TP41p41 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.