CD77 Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162583

Catalog No. NBP162583

Description

CD77 Synthase Polyclonal specifically detects CD77 Synthase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CD77 Synthase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group), A4GALT1, alpha 1,4-galactosyltransferase, Alpha-1,4-galactosyltransferase, Alpha-1,4-N-acetylglucosaminyltransferase, alpha4Gal-T1, CD77 synthase, EC 2.4.1.228, Gb3 synthase, Gb3S, Globotriaosylceramide synthase, lactosylceramide 4-alpha-galactosyltransferase, P blood group (P one antigen), P(k), P(k) antigen synthase, P1, P1/Pk synthase, PK, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NPC4
• Gene Symbols: A4GALT
• Immunogen: Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT (NP_059132). Peptide sequence RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 53947
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG