CD77 Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16258320UL

Catalog No. NBP16258320

Description

CD77 Synthase Polyclonal specifically detects CD77 Synthase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CD77 Synthase
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: Q9NPC4
• Gene Symbols: A4GALT
• Immunogen: Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT (NP_059132). Peptide sequence RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAF
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 53947
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group), A4GALT1, alpha 1,4-galactosyltransferase, Alpha-1,4-galactosyltransferase, Alpha-1,4-N-acetylglucosaminyltransferase, alpha4Gal-T1, CD77 synthase, EC 2.4.1.228, Gb3 synthase, Gb3S, Globotriaosylceramide synthase, lactosylceramide 4-alpha-galactosyltransferase, P blood group (P one antigen), P(k), P(k) antigen synthase, P1, P1/Pk synthase, PK, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG