CD79A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324725

Catalog No. NB301727

Description

CD79A Polyclonal antibody specifically detects CD79A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: CD79A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: CD79a antigen, CD79A antigen (immunoglobulin-associated alpha), CD79a molecule, immunoglobulin-associated alpha, IGAB-cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB1, MB-1, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CD79A using the following amino acid sequence: ALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPG
• Quantity: 100 μL
• Research Discipline: Adaptive Immunity, Cell Biology, Immunology, Phospho Specific
• Gene ID (Entrez): 973
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified