Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD8 Antibody (CL1529), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $646.00

Specifications

Antigen	CD8
Clone	CL1529
Dilution	Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Monoclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB436408 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23674325UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP236743 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP236743	0.1 mL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	CD8
Dilution	Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	P01732
Gene ID (Entrez)	925
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Primary or Secondary	Primary
Reconstitution	Protein A purified

Clone	CL1529
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Mouse
Research Discipline	Innate Immunity
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	CD8, CD8a molecule, LEU2, p32
Gene Symbols	CD8A
Isotype	IgG1
Purification Method	Protein A purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CD8 Antibody (CL1529), Novus Biologicals™

Specifications

Description

Specifications

Documents