Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD8 beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP258425

Catalog No. NBP258425

Add to cart



CD8 beta Polyclonal antibody specifically detects CD8 beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.


CD8 beta
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
CD8 antigen, beta polypeptide 1 (p37), CD8b antigen, CD8b molecule, CD8B1P37, LEU2, LY3, LYT3, MGC119115, T lymphocyte surface glycoprotein beta chain, T-cell surface glycoprotein CD8 beta chain
100 ul
Adaptive Immunity, Cytokine Research, Immunology, Innate Immunity, Signal Transduction, Stem Cell Markers
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EGISGTFVPQCLHGYYSNTTTSQKLLNPWILK
Affinity purified
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only