Cdc20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258408

Catalog No. NBP258408

Description

Cdc20 Polyclonal specifically detects Cdc20 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Cdc20
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CDC20 cell division cycle 20 homolog, CDC20 cell division cycle 20 homolog (S. cerevisiae), cell division cycle 20 homolog (S. cerevisiae), cell division cycle protein 20 homolog, MGC102824, p55CDCS. cerevisiae, homolog)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CDC20
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGK
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 991
• Target Species: Human
• Isotype: IgG

For Research Use Only