Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579013

Invitrogen™ CDC20 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579013
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579013 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579013 Supplier Invitrogen™ Supplier No. PA579013
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell. IHC: human colon cancer tissue, human lung cancer tissue, mouse small intestine tissue, rat small intestine tissue, human mammary cancer tissue. ICC/IF: NIH3T3 cell. Flow: SiHa cell, U20S cell.

Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CDC20
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CDC20
Gene Accession No. Q12834, Q62623, Q9JJ66
Gene Alias 2310042N09Rik; bA276H19.3; C87100; cdc20; CDC20 cell division cycle 20 homolog; cdc20.S; CDC20A; cell cycle protein p55CDC; cell division cycle 20; cell division cycle 20 homolog; cell division cycle 20 S homeolog; cell division cycle protein 20 homolog; fizzy1; mmCdc20; p55cdc; XELAEV_18025163mg; X-FZY
Gene Symbols CDC20
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human Cdc20 (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 107995, 64515, 991
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.