Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579017

Invitrogen™ CDC25C Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579017
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579017 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579017 Supplier Invitrogen™ Supplier No. PA579017
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, SW620 whole cell, MCF-7 whole cell.

M-phase inducer phosphatase 3is an enzyme that in humans is encoded by theCDC25Cgene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CDC25C
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Cdc25c
Gene Accession No. P30307
Gene Alias CDC25; CDC25C; Cdc25m1; cell division cycle 25C; dual specificity phosphatase CDC25C; EC 3.1.3.48; mitosis inducer CDC25; M-phase inducer phosphatase 3; MPIP3; OTTHUMP00000159490; OTTHUMP00000224012; OTTHUMP00000224013; OTTHUMP00000224016; phosphotyrosine phosphatase; PPP1R60; protein phosphatase 1, regulatory subunit 60
Gene Symbols Cdc25c
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435-473aa MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 995
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.