Cdc27 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18909525UL

Catalog No. NB430924

Description

Cdc27 Polyclonal specifically detects Cdc27 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: Cdc27
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
• Gene Alias: ANAPC3CDC27 homolog, anaphase promoting complex subunit 3, Anaphase-promoting complex subunit 3, anaphase-promoting complex, protein 3, APC 3, APC3cell division cycle 27, CDC27Hs, cell division cycle 27 homolog (S. cerevisiae), cell division cycle protein 27 homolog, D0S1430E, D17S978E, HNUC, H-NUC, NUC2, nuc2 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CDC27
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMG
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 996
• Target Species: Human
• Isotype: IgG

For Research Use Only