Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDC2L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25797125UL
Description
CDC2L2 Polyclonal specifically detects CDC2L2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CDC2L2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
CDK11-p110, CDK11-p58, cyclin-dependent kinase 11A, PITSLRE protein kinase beta | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
CDK11A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL | |
25 μL | |
Apoptosis, Cell Cycle and Replication, Cellular Markers, Protein Phosphatase, Signal Transduction | |
728642 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction