Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89968771

Abnova™ CDC2L5 Recombinant Protein

Catalog No. 89968771
Click to view available options
:
2 μg

Description

Used for AP, Array, ELISA, WB-Re

Sequence: MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK

Specifications

Accession Number AAH01274
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH = 8.0 in the elution buffer.
Gene ID (Entrez) 8621
Molecular Weight (g/mol) 35.53 kDa
Name CDC2L5 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 2 μg
Immunogen MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CDC2L, CHED, FLJ35215, KIAA1791
Common Name CDC2L5
Gene Symbol CDC2L5
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System Wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.